PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_357440g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 509aa    MW: 56495.1 Da    PI: 5.7901
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_357440g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding383.8e-122876148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ed +l +++ + G   +W+ +a+  g+ R++k+c++rw +yl
   MA_357440g0010 28 KGLWSPDEDNKLTNYIIRNGLMgCWNYVAKQAGLQRCGKSCRLRWINYL 76
                     678*****************667************************97 PP

2Myb_DNA-binding40.66.1e-1382125145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+ + +E+ l++++   lG+ +W+ Ia++++ gRt++++k++w+
   MA_357440g0010  82 RGPISRQEERLIIHLQSSLGNSRWSQIAAHLP-GRTDNEIKNYWN 125
                      788999**************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.822376IPR017930Myb domain
SuperFamilySSF466892.07E-2325124IPR009057Homeodomain-like
SMARTSM007171.2E-72778IPR001005SANT/Myb domain
PfamPF002492.3E-102876IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-202983IPR009057Homeodomain-like
CDDcd001673.16E-73176No hitNo description
PROSITE profilePS5129422.777132IPR017930Myb domain
SMARTSM007175.2E-1381130IPR001005SANT/Myb domain
PfamPF002491.2E-1182126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2284132IPR009057Homeodomain-like
CDDcd001679.63E-1184125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MGWTLGQRQE ATEGESVPSN PSRRRLRKGL WSPDEDNKLT NYIIRNGLMG CWNYVAKQAG  60
LQRCGKSCRL RWINYLRPGL KRGPISRQEE RLIIHLQSSL GNSRWSQIAA HLPGRTDNEI  120
KNYWNSSIKK KIMLKHDRPS AAAANGDXXX NRKSNFPFQS KRICNADSVP AHVQEVATSS  180
HSSQPYLQVM PVEGYQPHNS AFNILLATGE NQLCVPGLLE FKQEARDQND EFLIDRDLIN  240
PDFISPSLQT QGLYNYKAAR SSTCDELIAE SCRTTVAPHE VPGSANNYFL GSAGISIPAL  300
VERQTSKEKI ENEMLIDYSS FAASSGISAG SAGHSYSNIA ADFTDVYSGV SYTNELLGVR  360
ILEDLVSVHH EKTAHQSWPP LNFVAQVSAP SIRGANNLDA EDDWKDRPNL RYDVNLGVPT  420
YIDINSSLQT TYQIEGGGGF GDQLDFSRIL NEKENTNPIP AIFGGGNGAL EIHEYYEGEA  480
EQVTVWAQDN MCNINTAAAS SDPYQVYLT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-22261325108B-MYB
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12227RRRLRK
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-49myb domain protein 86